Anti CLIP4 pAb (ATL-HPA043366)

Atlas Antibodies

SKU: ATL-HPA043366-25

• 
• 
• 

Protein Description: CAP-GLY domain containing linker protein family, member 4
Gene Name: CLIP4
Alternative Gene Name: FLJ21069, RSNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024059: 86%, ENSRNOG00000008806: 86%
Entrez Gene ID: 79745
Uniprot ID: Q8N3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
• Gene Sequence: TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
• Gene ID - Mouse: ENSMUSG00000024059
• Gene ID - Rat: ENSRNOG00000008806
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.