Anti CLIP3 pAb (ATL-HPA079430 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA079430-25

• 

Protein Description: CAP-Gly domain containing linker protein 3
Gene Name: CLIP3
Alternative Gene Name: CLIPR-59, RSNL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013921: 97%, ENSRNOG00000050104: 97%
Entrez Gene ID: 25999
Uniprot ID: Q96DZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FICPPKQGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIV
• Gene Sequence: FICPPKQGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIV
• Gene ID - Mouse: ENSMUSG00000013921
• Gene ID - Rat: ENSRNOG00000050104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.