Anti CLEC16A pAb (ATL-HPA035815)

Atlas Antibodies

Catalog No.: ATL-HPA035815-25

Protein Description: C-type lectin domain family 16, member A
Gene Name: CLEC16A
Alternative Gene Name: Gop-1, KIAA0350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068663: 68%, ENSRNOG00000033522: 29%
Entrez Gene ID: 23274
Uniprot ID: Q2KHT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVETASLSPSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPV
• Gene Sequence: PMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVETASLSPSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPV
• Gene ID - Mouse: ENSMUSG00000068663
• Gene ID - Rat: ENSRNOG00000033522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.