Anti CLCN4 pAb (ATL-HPA031313 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031313-25

Protein Description: chloride channel, voltage-sensitive 4
Gene Name: CLCN4
Alternative Gene Name: ClC-4, CLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000605: 98%, ENSRNOG00000003533: 100%
Entrez Gene ID: 1183
Uniprot ID: P51793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
• Gene Sequence: VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
• Gene ID - Mouse: ENSMUSG00000000605
• Gene ID - Rat: ENSRNOG00000003533
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.