Anti CLCC1 pAb (ATL-HPA009087 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA009087-25

Protein Description: chloride channel CLIC-like 1
Gene Name: CLCC1
Alternative Gene Name: MCLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027884: 62%, ENSRNOG00000020360: 64%
Entrez Gene ID: 23155
Uniprot ID: Q96S66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE
• Gene Sequence: PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE
• Gene ID - Mouse: ENSMUSG00000027884
• Gene ID - Rat: ENSRNOG00000020360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLCC1 pAb (ATL-HPA009087 w/enhanced validation) – 1 Found

Chen, Zhen; Wang, Chao; Feng, Xu; Nie, Litong; Tang, Mengfan; Zhang, Huimin; Xiong, Yun; Swisher, Samuel K; Srivastava, Mrinal; Chen, Junjie. Interactomes of SARS-CoV-2 and human coronaviruses reveal host factors potentially affecting pathogenesis. The Embo Journal. 2021;40(17):e107776.