Anti CKAP4 pAb (ATL-HPA000278 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000278-25

Protein Description: cytoskeleton-associated protein 4
Gene Name: CKAP4
Alternative Gene Name: CLIMP-63, ERGIC-63, P63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046841: 73%, ENSRNOG00000008016: 68%
Entrez Gene ID: 10970
Uniprot ID: Q07065
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
• Gene Sequence: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
• Gene ID - Mouse: ENSMUSG00000046841
• Gene ID - Rat: ENSRNOG00000008016
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CKAP4 pAb (ATL-HPA000278 w/enhanced validation) – 1 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.