Anti CISD3 pAb (ATL-HPA053436)

Atlas Antibodies

Catalog No.: ATL-HPA053436-25

Protein Description: CDGSH iron sulfur domain 3
Gene Name: CISD3
Alternative Gene Name: Miner2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078695: 69%, ENSRNOG00000036894: 69%
Entrez Gene ID: 284106
Uniprot ID: P0C7P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQ
• Gene Sequence: GARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQ
• Gene ID - Mouse: ENSMUSG00000078695
• Gene ID - Rat: ENSRNOG00000036894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.