Anti CIB3 pAb (ATL-HPA043995)

Atlas Antibodies

Catalog No.: ATL-HPA043995-25

Protein Description: calcium and integrin binding family member 3
Gene Name: CIB3
Alternative Gene Name: KIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074240: 79%, ENSRNOG00000014600: 95%
Entrez Gene ID: 117286
Uniprot ID: Q96Q77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPR
• Gene Sequence: LEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPR
• Gene ID - Mouse: ENSMUSG00000074240
• Gene ID - Rat: ENSRNOG00000014600
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.