Anti CHMP2A pAb (ATL-HPA042031 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042031-25

• 

Protein Description: charged multivesicular body protein 2A
Gene Name: CHMP2A
Alternative Gene Name: BC-2, CHMP2, VPS2, VPS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033916: 100%, ENSRNOG00000043328: 100%
Entrez Gene ID: 27243
Uniprot ID: O43633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRA
• Gene Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRA
• Gene ID - Mouse: ENSMUSG00000033916
• Gene ID - Rat: ENSRNOG00000043328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.