Anti CHIC2 pAb (ATL-HPA076603)

Atlas Antibodies

Catalog No.: ATL-HPA076603-25

Protein Description: cysteine rich hydrophobic domain 2
Gene Name: CHIC2
Alternative Gene Name: BTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029229: 100%, ENSRNOG00000002267: 100%
Entrez Gene ID: 26511
Uniprot ID: Q9UKJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLS
• Gene Sequence: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLS
• Gene ID - Mouse: ENSMUSG00000029229
• Gene ID - Rat: ENSRNOG00000002267
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.