Anti CHD2 pAb (ATL-HPA060744 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060744-25

• 
• 

Protein Description: chromodomain helicase DNA binding protein 2
Gene Name: CHD2
Alternative Gene Name: DKFZp547I1315, DKFZp686E01200, DKFZp781D1727, FLJ38614
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078671: 96%, ENSRNOG00000012716: 96%
Entrez Gene ID: 1106
Uniprot ID: O14647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHWYKDHHYGDRRHMDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMS
• Gene Sequence: QHWYKDHHYGDRRHMDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMS
• Gene ID - Mouse: ENSMUSG00000078671
• Gene ID - Rat: ENSRNOG00000012716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHD2 pAb (ATL-HPA060744 w/enhanced validation) – 1 Found

Berson, Amit; Sartoris, Ashley; Nativio, Raffaella; Van Deerlin, Vivianna; Toledo, Jon B; Porta, Sílvia; Liu, Shichong; Chung, Chia-Yu; Garcia, Benjamin A; Lee, Virginia M-Y; Trojanowski, John Q; Johnson, F Brad; Berger, Shelley L; Bonini, Nancy M. TDP-43 Promotes Neurodegeneration by Impairing Chromatin Remodeling. Current Biology : Cb. 2017;27(23):3579-3590.e6.