Anti CHAD pAb (ATL-HPA018241 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018241-25

Protein Description: chondroadherin
Gene Name: CHAD
Alternative Gene Name: SLRR4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039084: 95%, ENSRNOG00000003304: 94%
Entrez Gene ID: 1101
Uniprot ID: O15335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTT
• Gene Sequence: LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTT
• Gene ID - Mouse: ENSMUSG00000039084
• Gene ID - Rat: ENSRNOG00000003304
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHAD pAb (ATL-HPA018241 w/enhanced validation) – 2 Found

Fu, Xing; Khalil, Hadi; Kanisicak, Onur; Boyer, Justin G; Vagnozzi, Ronald J; Maliken, Bryan D; Sargent, Michelle A; Prasad, Vikram; Valiente-Alandi, Iñigo; Blaxall, Burns C; Molkentin, Jeffery D. Specialized fibroblast differentiated states underlie scar formation in the infarcted mouse heart. The Journal Of Clinical Investigation. 2018;128(5):2127-2143. 

Hulin, Alexia; Hortells, Luis; Gomez-Stallons, M Victoria; O'Donnell, Anna; Chetal, Kashish; Adam, Mike; Lancellotti, Patrizio; Oury, Cecile; Potter, S Steven; Salomonis, Nathan; Yutzey, Katherine E. Maturation of heart valve cell populations during postnatal remodeling. Development (Cambridge, England). 2019;146(12)