Anti CFAP47 pAb (ATL-HPA044633)

Atlas Antibodies

Catalog No.: ATL-HPA044633-25

Protein Description: cilia and flagella associated protein 47
Gene Name: CFAP47
Alternative Gene Name: CHDC2, CXorf22, CXorf30, CXorf59, FLJ36601, MGC34831, RP13-11B7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073077: 72%, ENSRNOG00000016047: 20%
Entrez Gene ID: 286464
Uniprot ID: Q6ZTR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSM
• Gene Sequence: LQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSM
• Gene ID - Mouse: ENSMUSG00000073077
• Gene ID - Rat: ENSRNOG00000016047
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.