Anti CFAP157 pAb (ATL-HPA021786 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021786-25

Protein Description: cilia and flagella associated protein 157
Gene Name: CFAP157
Alternative Gene Name: C9orf117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038987: 56%, ENSRNOG00000039315: 55%
Entrez Gene ID: 286207
Uniprot ID: Q5JU67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSST
• Gene Sequence: DNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSST
• Gene ID - Mouse: ENSMUSG00000038987
• Gene ID - Rat: ENSRNOG00000039315
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.