Anti CERCAM pAb (ATL-HPA021657)

Atlas Antibodies

SKU: ATL-HPA021657-25

• 

Protein Description: cerebral endothelial cell adhesion molecule
Gene Name: CERCAM
Alternative Gene Name: CEECAM1, CerCAM, GLT25D3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039787: 81%, ENSRNOG00000026604: 84%
Entrez Gene ID: 51148
Uniprot ID: Q5T4B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG
• Gene Sequence: TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG
• Gene ID - Mouse: ENSMUSG00000039787
• Gene ID - Rat: ENSRNOG00000026604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.