Anti CEP85L pAb (ATL-HPA029138)

Atlas Antibodies

Catalog No.: ATL-HPA029138-25

Protein Description: centrosomal protein 85kDa-like
Gene Name: CEP85L
Alternative Gene Name: bA57K17.2, C6orf204, NY-BR-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038594: 78%, ENSRNOG00000000414: 68%
Entrez Gene ID: 387119
Uniprot ID: Q5SZL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEK
• Gene Sequence: SKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEK
• Gene ID - Mouse: ENSMUSG00000038594
• Gene ID - Rat: ENSRNOG00000000414
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.