Anti CEP170 pAb (ATL-HPA045597)

Atlas Antibodies

Catalog No.: ATL-HPA045597-25

Protein Description: centrosomal protein 170
Gene Name: CEP170
Alternative Gene Name: FAM68A, KAB, KIAA0470
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057335: 88%, ENSRNOG00000033688: 34%
Entrez Gene ID: 9859
Uniprot ID: Q5SW79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTL
• Gene Sequence: KQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTL
• Gene ID - Mouse: ENSMUSG00000057335
• Gene ID - Rat: ENSRNOG00000033688
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.