Anti CEP170 pAb (ATL-HPA042151)

Atlas Antibodies

Catalog No.: ATL-HPA042151-25

Protein Description: centrosomal protein 170kDa
Gene Name: CEP170
Alternative Gene Name: FAM68A, KAB, KIAA0470
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057335: 94%, ENSRNOG00000033688: 34%
Entrez Gene ID: 9859
Uniprot ID: Q5SW79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPPLVHSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKT
• Gene Sequence: IPPLVHSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKT
• Gene ID - Mouse: ENSMUSG00000057335
• Gene ID - Rat: ENSRNOG00000033688
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEP170 pAb (ATL-HPA042151) – 1 Found

Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649)