Anti CENPV pAb (ATL-HPA042529 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042529-25

Protein Description: centromere protein V
Gene Name: CENPV
Alternative Gene Name: CENP-V, p30, PRR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018509: 97%, ENSRNOG00000003086: 97%
Entrez Gene ID: 201161
Uniprot ID: Q7Z7K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
• Gene Sequence: HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
• Gene ID - Mouse: ENSMUSG00000018509
• Gene ID - Rat: ENSRNOG00000003086
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.