Anti CENPT pAb (ATL-HPA041220)

Atlas Antibodies

Catalog No.: ATL-HPA041220-25

Protein Description: centromere protein T
Gene Name: CENPT
Alternative Gene Name: C16orf56, CENP-T, FLJ13111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036672: 73%, ENSRNOG00000024178: 72%
Entrez Gene ID: 80152
Uniprot ID: Q96BT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
• Gene Sequence: RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
• Gene ID - Mouse: ENSMUSG00000036672
• Gene ID - Rat: ENSRNOG00000024178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.