Anti CELF5 pAb (ATL-HPA060336 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA060336-25

Protein Description: CUGBP, Elav-like family member 5
Gene Name: CELF5
Alternative Gene Name: BRUNOL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034818: 91%, ENSRNOG00000004695: 91%
Entrez Gene ID: 60680
Uniprot ID: Q8N6W0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQ
• Gene Sequence: AQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQ
• Gene ID - Mouse: ENSMUSG00000034818
• Gene ID - Rat: ENSRNOG00000004695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.