Anti CDKN2A pAb (ATL-HPA047838)

Atlas Antibodies

Catalog No.: ATL-HPA047838-25

Protein Description: cyclin-dependent kinase inhibitor 2A
Gene Name: CDKN2A
Alternative Gene Name: ARF, CDK4I, CDKN2, CMM2, INK4, INK4a, MLM, MTS1, p14, p14ARF, p16, p16INK4a, p19, p19Arf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044303: 44%, ENSRNOG00000059837: 43%
Entrez Gene ID: 1029
Uniprot ID: Q8N726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
• Gene Sequence: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
• Gene ID - Mouse: ENSMUSG00000044303
• Gene ID - Rat: ENSRNOG00000059837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.