Anti CDKL1 pAb (ATL-HPA059605)

Atlas Antibodies

Catalog No.: ATL-HPA059605-25

Protein Description: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Gene Name: CDKL1
Alternative Gene Name: KKIALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020990: 90%, ENSRNOG00000038720: 90%
Entrez Gene ID: 8814
Uniprot ID: Q00532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
• Gene Sequence: RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
• Gene ID - Mouse: ENSMUSG00000020990
• Gene ID - Rat: ENSRNOG00000038720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.