Anti CDHR5 pAb (ATL-HPA009081 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA009081-25

• 

Protein Description: cadherin-related family member 5
Gene Name: CDHR5
Alternative Gene Name: FLJ20219, MU-PCDH, MUCDHL, MUPCDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025497: 60%, ENSRNOG00000017762: 65%
Entrez Gene ID: 53841
Uniprot ID: Q9HBB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGDRGINQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYRGTVARGAGAGVVVKDA
• Gene Sequence: CIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGDRGINQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYRGTVARGAGAGVVVKDA
• Gene ID - Mouse: ENSMUSG00000025497
• Gene ID - Rat: ENSRNOG00000017762
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDHR5 pAb (ATL-HPA009081 w/enhanced validation) – 3 Found

McConnell, Russell E; Benesh, Andrew E; Mao, Suli; Tabb, David L; Tyska, Matthew J. Proteomic analysis of the enterocyte brush border. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2011;300(5):G914-26. 

Meenderink, Leslie M; Gaeta, Isabella M; Postema, Meagan M; Cencer, Caroline S; Chinowsky, Colbie R; Krystofiak, Evan S; Millis, Bryan A; Tyska, Matthew J. Actin Dynamics Drive Microvillar Motility and Clustering during Brush Border Assembly. Developmental Cell. 2019;50(5):545-556.e4. 

Weck, Meredith L; Crawley, Scott W; Tyska, Matthew J. A heterologous in-cell assay for investigating intermicrovillar adhesion complex interactions reveals a novel protrusion length-matching mechanism. The Journal Of Biological Chemistry. 2020;295(48):16191-16206.