Anti CDCP1 pAb (ATL-HPA010978 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010978-25

• 

Protein Description: CUB domain containing protein 1
Gene Name: CDCP1
Alternative Gene Name: CD318, SIMA135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035498: 78%, ENSRNOG00000004743: 81%
Entrez Gene ID: 64866
Uniprot ID: Q9H5V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKHKISFLCDDLTRLWMNVEKTISCTDHRYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSFSYLVASAIPSQDLYFGSFCPGGSIKQIQVKQ
• Gene Sequence: SKHKISFLCDDLTRLWMNVEKTISCTDHRYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSFSYLVASAIPSQDLYFGSFCPGGSIKQIQVKQ
• Gene ID - Mouse: ENSMUSG00000035498
• Gene ID - Rat: ENSRNOG00000004743
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDCP1 pAb (ATL-HPA010978 w/enhanced validation) – 1 Found

Iwata, Mineo; Torok-Storb, Beverly; Wayner, Elizabeth A; Carter, William G. CDCP1 identifies a CD146 negative subset of marrow fibroblasts involved with cytokine production. Plos One. 9(10):e109304.