Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA076007-25

• 

Protein Description: cell division cycle associated 5
Gene Name: CDCA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024791: 60%, ENSRNOG00000046635: 44%
Entrez Gene ID: 113130
Uniprot ID: Q96FF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
• Gene Sequence: RSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
• Gene ID - Mouse: ENSMUSG00000024791
• Gene ID - Rat: ENSRNOG00000046635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.