Anti CDC6 pAb (ATL-HPA050114)

Atlas Antibodies

Catalog No.: ATL-HPA050114-25

Protein Description: cell division cycle 6
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 91%, ENSRNOG00000027787: 87%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP
• Gene Sequence: CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP
• Gene ID - Mouse: ENSMUSG00000017499
• Gene ID - Rat: ENSRNOG00000027787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDC6 pAb (ATL-HPA050114) – 1 Found

Xie, Zucheng; Dang, Yiwu; Wu, Huayu; He, Rongquan; Ma, Jie; Peng, Zhigang; Rong, Minhua; Li, Zhekun; Yang, Jiapeng; Jiang, Yizhao; Chen, Gang; Yang, Lihua. Effect of CELSR3 on the Cell Cycle and Apoptosis of Hepatocellular Carcinoma Cells. Journal Of Cancer. 11(10):2830-2844.