Anti CDC5L pAb (ATL-HPA006302)

Atlas Antibodies

Catalog No.: ATL-HPA006302-100

Protein Description: cell division cycle 5-like
Gene Name: CDC5L
Alternative Gene Name: CDC5, CEF1, hCDC5, PCDC5RP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023932: 96%, ENSRNOG00000019975: 96%
Entrez Gene ID: 988
Uniprot ID: Q99459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHM
• Gene Sequence: DLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHM
• Gene ID - Mouse: ENSMUSG00000023932
• Gene ID - Rat: ENSRNOG00000019975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.