Anti CDC42EP1 pAb (ATL-HPA006379)

Atlas Antibodies

Catalog No.: ATL-HPA006379-25

Protein Description: CDC42 effector protein (Rho GTPase binding) 1
Gene Name: CDC42EP1
Alternative Gene Name: Borg5, CEP1, MSE55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049521: 61%, ENSRNOG00000008517: 54%
Entrez Gene ID: 11135
Uniprot ID: Q00587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGV
• Gene Sequence: SGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGV
• Gene ID - Mouse: ENSMUSG00000049521
• Gene ID - Rat: ENSRNOG00000008517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDC42EP1 pAb (ATL-HPA006379) – 1 Found

Sawada, Junko; Perrot, Carole Y; Chen, Linyuan; Fournier-Goss, Ashley E; Oyer, Jeremiah; Copik, Alicja; Komatsu, Masanobu. High Endothelial Venules Accelerate Naive T Cell Recruitment by Tumor Necrosis Factor-Mediated R-Ras Upregulation. The American Journal Of Pathology. 2021;191(2):396-414.