Anti CDC25B pAb (ATL-HPA038893 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038893-25

Protein Description: cell division cycle 25B
Gene Name: CDC25B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027330: 82%, ENSRNOG00000021248: 79%
Entrez Gene ID: 994
Uniprot ID: P30305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEI
• Gene Sequence: LVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEI
• Gene ID - Mouse: ENSMUSG00000027330
• Gene ID - Rat: ENSRNOG00000021248
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.