Anti CD84 pAb (ATL-HPA063316)

Atlas Antibodies

Catalog No.: ATL-HPA063316-25

Protein Description: CD84 molecule
Gene Name: CD84
Alternative Gene Name: hCD84, mCD84, SLAMF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038147: 51%, ENSRNOG00000022884: 53%
Entrez Gene ID: 8832
Uniprot ID: Q9UIB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS
• Gene Sequence: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS
• Gene ID - Mouse: ENSMUSG00000038147
• Gene ID - Rat: ENSRNOG00000022884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.