Anti CD300A pAb (ATL-HPA011645)

Atlas Antibodies

Catalog No.: ATL-HPA011645-25

Protein Description: CD300a molecule
Gene Name: CD300A
Alternative Gene Name: CMRF-35-H9, CMRF35H, IGSF12, IRC1, IRC2, Irp60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034652: 31%, ENSRNOG00000057058: 41%
Entrez Gene ID: 11314
Uniprot ID: Q9UGN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
• Gene Sequence: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
• Gene ID - Mouse: ENSMUSG00000034652
• Gene ID - Rat: ENSRNOG00000057058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.