Anti CD2BP2 pAb (ATL-HPA061309 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061309-25

• 
• 

Protein Description: CD2 (cytoplasmic tail) binding protein 2
Gene Name: CD2BP2
Alternative Gene Name: LIN1, PPP1R59, Snu40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042502: 90%, ENSRNOG00000017201: 94%
Entrez Gene ID: 10421
Uniprot ID: O95400
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEE
• Gene Sequence: MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEE
• Gene ID - Mouse: ENSMUSG00000042502
• Gene ID - Rat: ENSRNOG00000017201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.