Anti CCPG1 pAb (ATL-HPA009432)

Atlas Antibodies

Catalog No.: ATL-HPA009432-25

Protein Description: cell cycle progression 1
Gene Name: CCPG1
Alternative Gene Name: CPR8, KIAA1254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034563: 76%, ENSRNOG00000053428: 73%
Entrez Gene ID: 9236
Uniprot ID: Q9ULG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
• Gene Sequence: DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
• Gene ID - Mouse: ENSMUSG00000034563
• Gene ID - Rat: ENSRNOG00000053428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.