Anti CCP110 pAb (ATL-HPA039402 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039402-25

• 
• 

Protein Description: centriolar coiled coil protein 110kDa
Gene Name: CCP110
Alternative Gene Name: CP110, KIAA0419
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033904: 75%, ENSRNOG00000027405: 79%
Entrez Gene ID: 9738
Uniprot ID: O43303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK
• Gene Sequence: DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK
• Gene ID - Mouse: ENSMUSG00000033904
• Gene ID - Rat: ENSRNOG00000027405
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.