Anti CCM2 pAb (ATL-HPA021669 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021669-25

• 

Protein Description: cerebral cavernous malformation 2
Gene Name: CCM2
Alternative Gene Name: C7orf22, MGC4607
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000378: 99%, ENSRNOG00000060825: 98%
Entrez Gene ID: 83605
Uniprot ID: Q9BSQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSR
• Gene Sequence: GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSR
• Gene ID - Mouse: ENSMUSG00000000378
• Gene ID - Rat: ENSRNOG00000060825
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.