Anti CCDC9 pAb (ATL-HPA045624 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045624-25

Protein Description: coiled-coil domain containing 9
Gene Name: CCDC9
Alternative Gene Name: DKFZP586M1019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041375: 86%, ENSRNOG00000048848: 88%
Entrez Gene ID: 26093
Uniprot ID: Q9Y3X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE
• Gene Sequence: IEEDRKKAELEGVAVTAPRKGRSVEKENVAVESEKNLGPSRRSPGTPRPPGASKGGRTPPQQGGRAGMGRASRSWE
• Gene ID - Mouse: ENSMUSG00000041375
• Gene ID - Rat: ENSRNOG00000048848
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.