Anti CCDC81 pAb (ATL-HPA040827)

Atlas Antibodies

Catalog No.: ATL-HPA040827-25

Protein Description: coiled-coil domain containing 81
Gene Name: CCDC81
Alternative Gene Name: FLJ16339, FLJ23514
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039391: 77%, ENSRNOG00000033733: 44%
Entrez Gene ID: 60494
Uniprot ID: Q6ZN84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERVNRVNQCLQEDWERSA
• Gene Sequence: SEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERVNRVNQCLQEDWERSA
• Gene ID - Mouse: ENSMUSG00000039391
• Gene ID - Rat: ENSRNOG00000033733
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.