Anti CCDC181 pAb (ATL-HPA027281 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027281-25

• 

Protein Description: coiled-coil domain containing 181
Gene Name: CCDC181
Alternative Gene Name: C1orf114, FLJ25846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026578: 68%, ENSRNOG00000002860: 65%
Entrez Gene ID: 57821
Uniprot ID: Q5TID7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSDASIIEMACEKEENINQDLKENETVMEHTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKL
• Gene Sequence: KSDASIIEMACEKEENINQDLKENETVMEHTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKL
• Gene ID - Mouse: ENSMUSG00000026578
• Gene ID - Rat: ENSRNOG00000002860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.