Anti CCDC170 pAb (ATL-HPA027114 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027114-25

Protein Description: coiled-coil domain containing 170
Gene Name: CCDC170
Alternative Gene Name: bA282P11.1, C6orf97, FLJ23305
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019767: 71%, ENSRNOG00000024280: 76%
Entrez Gene ID: 80129
Uniprot ID: Q8IYT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMA
• Gene Sequence: RMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMA
• Gene ID - Mouse: ENSMUSG00000019767
• Gene ID - Rat: ENSRNOG00000024280
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CCDC170 pAb (ATL-HPA027114 w/enhanced validation) – 1 Found

Jiang, Pengtao; Li, Yueran; Poleshko, Andrey; Medvedeva, Valentina; Baulina, Natalia; Zhang, Yongchao; Zhou, Yan; Slater, Carolyn M; Pellegrin, Trinity; Wasserman, Jason; Lindy, Michael; Efimov, Andrey; Daly, Mary; Katz, Richard A; Chen, Xiaowei. The Protein Encoded by the CCDC170 Breast Cancer Gene Functions to Organize the Golgi-Microtubule Network. Ebiomedicine. 2017;22( 28687497):28-43.