Anti CCDC144A pAb (ATL-HPA022996)

Atlas Antibodies

Catalog No.: ATL-HPA022996-25

Protein Description: coiled-coil domain containing 144A
Gene Name: CCDC144A
Alternative Gene Name: FLJ43983, KIAA0565
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 53%, ENSRNOG00000006717: 51%
Entrez Gene ID: 9720
Uniprot ID: A2RUR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEWVRLHDKMKVDMSGLQAKNEILSEKLSNAESKINSLQIQLHNTRDALGRESLILERVQRDLSQ
• Gene Sequence: MESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEWVRLHDKMKVDMSGLQAKNEILSEKLSNAESKINSLQIQLHNTRDALGRESLILERVQRDLSQ
• Gene ID - Mouse: ENSMUSG00000007827
• Gene ID - Rat: ENSRNOG00000006717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.