Anti CCDC14 pAb (ATL-HPA035278)

Atlas Antibodies

Catalog No.: ATL-HPA035278-25

Protein Description: coiled-coil domain containing 14
Gene Name: CCDC14
Alternative Gene Name: DKFZp434L1050, FLJ12892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022833: 52%, ENSRNOG00000021469: 43%
Entrez Gene ID: 64770
Uniprot ID: Q49A88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCTDVLRNSFNTSPGVPCSLPKTDISAIPTLQQLGLVNGILPQQGIHKETDLLKCIQTYLSLFRSHGKETHLDSQTHRSPTQSQPAFLA
• Gene Sequence: TCTDVLRNSFNTSPGVPCSLPKTDISAIPTLQQLGLVNGILPQQGIHKETDLLKCIQTYLSLFRSHGKETHLDSQTHRSPTQSQPAFLA
• Gene ID - Mouse: ENSMUSG00000022833
• Gene ID - Rat: ENSRNOG00000021469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.