Anti CCDC137 pAb (ATL-HPA053914)

Atlas Antibodies

Catalog No.: ATL-HPA053914-25

Protein Description: coiled-coil domain containing 137
Gene Name: CCDC137
Alternative Gene Name: MGC16597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049957: 49%, ENSRNOG00000048712: 55%
Entrez Gene ID: 339230
Uniprot ID: Q6PK04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQ
• Gene Sequence: QRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQ
• Gene ID - Mouse: ENSMUSG00000049957
• Gene ID - Rat: ENSRNOG00000048712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.