Anti CBX3 pAb (ATL-HPA004902 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004902-25

Protein Description: chromobox homolog 3
Gene Name: CBX3
Alternative Gene Name: HP1Hs-gamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029836: 100%, ENSRNOG00000011814: 100%
Entrez Gene ID: 11335
Uniprot ID: Q13185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
• Gene Sequence: RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
• Gene ID - Mouse: ENSMUSG00000029836
• Gene ID - Rat: ENSRNOG00000011814
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CBX3 pAb (ATL-HPA004902 w/enhanced validation) – 1 Found

Yan, Lei; Xing, Zhaoquan; Guo, Zhaoxin; Fang, Zhiqing; Jiao, Wei; Guo, Xiaoyu; Xu, Zhonghua; Fang, Zhenghui; Liu, Zhaoxu. Somatostatin derivative (smsDX) targets cellular metabolism in prostate cancer cells after androgen deprivation therapy. Plos One. 8(2):e55790.