Anti CBR4 pAb (ATL-HPA037499 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037499-25

Protein Description: carbonyl reductase 4
Gene Name: CBR4
Alternative Gene Name: FLJ14431, SDR45C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031641: 89%, ENSRNOG00000024411: 86%
Entrez Gene ID: 84869
Uniprot ID: Q8N4T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSAS
• Gene Sequence: FLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSAS
• Gene ID - Mouse: ENSMUSG00000031641
• Gene ID - Rat: ENSRNOG00000024411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.