Anti CBFA2T3 pAb (ATL-HPA065890)

Atlas Antibodies

Catalog No.: ATL-HPA065890-25

Protein Description: core-binding factor, runt domain, alpha subunit 2; translocated to, 3
Gene Name: CBFA2T3
Alternative Gene Name: MTG16, MTGR2, ZMYND4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006362: 42%, ENSRNOG00000014723: 45%
Entrez Gene ID: 863
Uniprot ID: O75081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR
• Gene Sequence: SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR
• Gene ID - Mouse: ENSMUSG00000006362
• Gene ID - Rat: ENSRNOG00000014723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.