Anti CASP6 pAb (ATL-HPA011337 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA011337-25

• 
• 
• 

Protein Description: caspase 6, apoptosis-related cysteine peptidase
Gene Name: CASP6
Alternative Gene Name: MCH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027997: 91%, ENSRNOG00000052613: 91%
Entrez Gene ID: 839
Uniprot ID: P55212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV
• Gene Sequence: DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV
• Gene ID - Mouse: ENSMUSG00000027997
• Gene ID - Rat: ENSRNOG00000052613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.