Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049488-25

• 
• 

Protein Description: cancer susceptibility candidate 4
Gene Name: CASC4
Alternative Gene Name: DKFZp459F1927, H63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060227: 83%, ENSRNOG00000016357: 82%
Entrez Gene ID: 113201
Uniprot ID: Q6P4E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG
• Gene Sequence: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG
• Gene ID - Mouse: ENSMUSG00000060227
• Gene ID - Rat: ENSRNOG00000016357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CASC4 pAb (ATL-HPA049488 w/enhanced validation) – 1 Found

van Bommel, Danique M; Toonen, Ruud F; Verhage, Matthijs. Mapping localization of 21 endogenous proteins in the Golgi apparatus of rodent neurons. Scientific Reports. 2023;13(1):2871.