Anti CASC1 pAb (ATL-HPA039662 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039662-25

• 

Protein Description: cancer susceptibility candidate 1
Gene Name: CASC1
Alternative Gene Name: FLJ10921, LAS1, PPP1R54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043541: 65%, ENSRNOG00000027630: 61%
Entrez Gene ID: 55259
Uniprot ID: Q6TDU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESEAIKCEREMKVLSETVSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKY
• Gene Sequence: ESEAIKCEREMKVLSETVSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKY
• Gene ID - Mouse: ENSMUSG00000043541
• Gene ID - Rat: ENSRNOG00000027630
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.