Anti CARF pAb (ATL-HPA034557)

Atlas Antibodies

Catalog No.: ATL-HPA034557-25

Protein Description: calcium responsive transcription factor
Gene Name: CARF
Alternative Gene Name: ALS2CR8, CaRF, FLJ21579, NYD-SP24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026017: 87%, ENSRNOG00000017491: 88%
Entrez Gene ID: 79800
Uniprot ID: Q8N187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVYNSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTK
• Gene Sequence: SQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVYNSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTK
• Gene ID - Mouse: ENSMUSG00000026017
• Gene ID - Rat: ENSRNOG00000017491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.